PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00026_0540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 786aa    MW: 84465.4 Da    PI: 5.6601
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00026_0540genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.44.5e-1066107648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +eEd  l   v++ G+++W++  r +g +Rt+kqc++rw+++l
    kfl00026_0540  66 QEEDVVLRAFVAKEGMDRWASAGRVLG-KRTGKQCRNRWYNVL 107
                      7**************************.************986 PP

2Myb_DNA-binding50.64.6e-16115155345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eE+++lv ++++ G++ W+  ar+m+ gR+++ +k++w+
    kfl00026_0540 115 DWTEEEEQRLVALHREIGSR-WAMLARHMP-GRSENAIKNHWH 155
                      6*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.3E-560109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-1766114IPR009057Homeodomain-like
PfamPF002493.8E-866107IPR001005SANT/Myb domain
PROSITE profilePS500908.53766107IPR017877Myb-like domain
CDDcd001672.87E-966107No hitNo description
SuperFamilySSF466892.62E-2390160IPR009057Homeodomain-like
PROSITE profilePS5129419.672108162IPR017930Myb domain
SMARTSM007171.4E-11112160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-17115158IPR009057Homeodomain-like
PfamPF002495.0E-13115155IPR001005SANT/Myb domain
CDDcd001678.79E-11116155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MKPHMPVSLD ASVDCDMPSC LIGREENEPA EPGEGLEREG SGSSSSMDGS QRSKEDARAR  60
INDEHQEEDV VLRAFVAKEG MDRWASAGRV LGKRTGKQCR NRWYNVLDPN LTDSDWTEEE  120
EQRLVALHRE IGSRWAMLAR HMPGRSENAI KNHWHCTARC KDLRNVKRAR NGILRNYIAQ  180
YSGDSSPTEA HPSKPEIIGP NPEKGKRRAK KKRRVLSQTA KNTSASDDDV SAEVKQEDAA  240
SADSEEEPLS QRARLGRRAP SHDVSSSVRA PKSEANGHVA DVMDGTEEGT LRKMGGVSET  300
TGFGGVVVGG GRSEVRETYA PSPPPGQQRG SRWLQVLEQP CSGNDDVSNP SVRFRCPDTH  360
ADRERVSPSG VGKGRPLRGS RGGGFSWAQH PPKGDQTSKD QVSDADVAPP CAFLAETLPS  420
TEQCFFTATQ SKMLTRGGLT NDLLGTEEND GTGGKRKADR NDWWGAGSIP PQSGQFKKPR  480
PLLIDNPAAL PLKSPHVGTP SLNETSRSFP LTPSLTSGVC QTVSVQTPSS SAPFPGALVA  540
HSLTQKLPLF NFGAETGSEP NLDLTSLVME HINGLLDQQA EKLSLVDPSV PESPTISSGE  600
LFEQHSQLRA ALEFLTSLMA RGKPEGGRGI LPALRTKSAA SNHSPIETTG ESHSQGPANP  660
FLPDQSTEEA PWALRSSVDD RTALEFLEKT GDDVGDATGG IIQNLPAAGS LPSGDPHAFP  720
RPSEWQPFSL QEHVGAEPGA TCCPGTGPVD NGFLGPTTPV TSDWDERLRE LTWAEGGAFG  780
GFQSGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C4e-24661619104C-Myb DNA-Binding Domain
1mse_C4e-24661619104C-Myb DNA-Binding Domain
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209213KKKRR
2209214KKKRRV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40360.13e-27myb domain protein 115